PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015577.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family HD-ZIP
Protein Properties Length: 816aa    MW: 87215.7 Da    PI: 6.7568
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015577.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-20112167156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe+lF+++++p++++r eL+k+l L+ rqVk+WFqNrR+++k
  Aco015577.1 112 KKRYHRHTPQQIQELETLFKECPHPDEKQRLELSKRLCLESRQVKFWFQNRRTQMK 167
                  678899***********************************************999 PP

2START192.42.2e-603245481205
                  HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
        START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                  ela++a++elvk+a+ eep+W  s     +  n++e+ + f++  +     + +ea+r++g+v+  +a lve+l+d + +W e+++    +a+t+evi
  Aco015577.1 324 ELALAAMDELVKMAQMEEPLWIPSLeggrDTVNYEEYSRAFPQCVGvkpvgFVSEASRETGIVIISSAALVETLMDAA-RWLEMFPsmiaRASTTEVI 420
                  5899*********************99999999****999977544999*****************************.******************* PP

                  CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
        START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                  s g      galqlm aelq+lsplvp R+  f+R+++ql +g w+++dvSvd  +++ +     +++++lpSg+++++++ng++kvtwveh++++++
  Aco015577.1 421 SGGmggsrnGALQLMHAELQVLSPLVPiREINFLRFCKQLAEGAWAVADVSVDAIRENHSnPTANMKCRRLPSGCVVQDMPNGYCKVTWVEHAEYDEA 518
                  *****************************************************9999987656679******************************** PP

                  XXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
        START 176 lphwllrslvksglaegaktwvatlqrqce 205
                   +h+l+r+l++sgla ga +w+a lqrqce
  Aco015577.1 519 AVHQLYRPLLRSGLALGAPRWLAILQRQCE 548
                  *****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-2196169IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-22105177IPR009057Homeodomain-like
PROSITE profilePS5007117.702109169IPR001356Homeobox domain
SMARTSM003891.2E-16110173IPR001356Homeobox domain
CDDcd000869.63E-18111170No hitNo description
PfamPF000463.8E-18112167IPR001356Homeobox domain
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PROSITE profilePS5084844.794315552IPR002913START domain
SuperFamilySSF559612.87E-33318549No hitNo description
SMARTSM002341.7E-43324549IPR002913START domain
PfamPF018524.7E-52324548IPR002913START domain
CDDcd088753.52E-116330548No hitNo description
SuperFamilySSF559612.34E-17621807No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 816 aa     Download sequence    Send to blast
MSFGGLFDSG GSGGLLSGGG GGGGAISQPP RSLPHKPTIF SSPALSLALQ TNMEGQGDRN  60
SLAVVTNVGG RVLDSAQGAN REEENESRSG SDHLDAVSAD DMEPDPNPRK RKKRYHRHTP  120
QQIQELETLF KECPHPDEKQ RLELSKRLCL ESRQVKFWFQ NRRTQMKTQM ERHENTILRQ  180
ENDKLRAENL AIREAMRNPI CSSCGGPAVL GEISLEEQHL RIENARLKDE LDRVCALAGK  240
FMGKPAPAVG APLPLPMPNS SLELAVGTNA YAALGAVPAA ALPALTDFPT TVSSPLGTVI  300
TPARTAGGGI VGVDKSLERS LLLELALAAM DELVKMAQME EPLWIPSLEG GRDTVNYEEY  360
SRAFPQCVGV KPVGFVSEAS RETGIVIISS AALVETLMDA ARWLEMFPSM IARASTTEVI  420
SGGMGGSRNG ALQLMHAELQ VLSPLVPIRE INFLRFCKQL AEGAWAVADV SVDAIRENHS  480
NPTANMKCRR LPSGCVVQDM PNGYCKVTWV EHAEYDEAAV HQLYRPLLRS GLALGAPRWL  540
AILQRQCEGL AILMSSPGPN LDTATITAGG RRSMLKLAQR MTDNFCAGVS ASSAHKWTKL  600
VGAAAVAAAG RGGGGGAMGV EEEVRVMTRQ SVDDPGEPPG VVLSAATSVW VPAVPPHRLF  660
DFLRDERLRS QWDILSNGGP MHQMAHIPKG HHHGNAVSLL RAAAASANQS SMLILQETCT  720
DASGSMVVYA PVDIPAMHLL MNGGDAAYVA LLPSGFAILP DANRSSPGSL LTVAFQILVN  780
SQPTAKLTVE SVETVNNLIS CTIKKIKAAL HCDTT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107113PRKRKKR
2108112RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6648271e-102KM664827.1 Ananas bracteatus clone 49827c microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933869.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLF6I3160.0F6I316_VITVI; Putative uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein